DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and CG30281

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster


Alignment Length:276 Identity:89/276 - (32%)
Similarity:131/276 - (47%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 ILNSKEAEIARLEFKIDES-----KLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEFVLL 228
            :|::.::....|.:|..||     |:::.:|:.:.|          ||..|...:...:....|.
  Fly    16 LLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSYK----------EITEERGSHETINPSSCLA 70

  Fly   229 GSSKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGS--FDNATESNIITGCGDLGGEF 291
            .......|.::.:|..||| .|:.|...||.||.:||||.|||  |....| ....|.|:|.|||
  Fly    71 AGINSNGIHVIEVPGLEPF-PVYCDTRLAGSGWTVIQRRQDGSENFYRCWE-EYSQGFGELSGEF 133

  Fly   292 WLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSH 356
            ::||:|||.:||....||::.:.||:.....|||::|.||:....|.|..||:|||:|||:.|.|
  Fly   134 FMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYH 198

  Fly   357 INHIIVGNPFA-------------MESSKWW--GTMNCNLNGKY-RNSKVELDTTD-GIWWGNWN 404
                 .|.||:             :....||  .....||||:| ...:.|...:. ||.|.:|.
  Fly   199 -----KGMPFSTFDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWR 258

  Fly   405 VGNRYPLKSCKMLIRP 420
             |..|..|..:|:|||
  Fly   259 -GYDYGYKFVQMMIRP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 9/47 (19%)
FReD 245..421 CDD:294064 75/195 (38%)
CG30281NP_726164.1 FReD 63..274 CDD:238040 78/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.