DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Fgl1

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus


Alignment Length:291 Identity:89/291 - (30%)
Similarity:131/291 - (45%) Gaps:66/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 AEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDH---------DEFVLLGS 230
            |::.:||.::.:.::.|.||   :..|:.:.:...:..|..::..|.|         |.|...|.
  Rat    37 AQVRQLETRVKQQQVVIAQL---LHEKEVQFLDRGQEDSFIDLGGKRHYADCSEIYNDGFKHSGF 98

  Fly   231 SKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGS-------------FDNATESNIIT 282
            .|:..::  :|.:|    ||:.|: |.|.||.:||||.|||             |.|..:||   
  Rat    99 YKIKPLQ--SLAEF----SVYCDM-SDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQSN--- 153

  Fly   283 GCGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSG 347
                  ||:|||.:.::.:|......|.|.|.||:..|.:|:|:.|.:||||..|: |::|||||
  Rat   154 ------GEYWLGNKNINLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYE-LNIGEYSG 211

  Fly   348 NAGDAF---------------------RSHINHIIVGNPFAMESSKWWGTM--NCNLNGKYRNSK 389
            .|||:.                     |...|....||....|.|.||...  :.||||.|....
  Rat   212 TAGDSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGNCAEEEQSGWWFNRCHSANLNGVYYQGP 276

  Fly   390 VELDTTDGIWWGNWNVGNRYPLKSCKMLIRP 420
            ...:|.:|:.|..|. |..|.|||..|.|||
  Rat   277 YRAETDNGVVWYTWR-GWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 7/36 (19%)
FReD 245..421 CDD:294064 73/212 (34%)
Fgl1NP_742007.2 FReD 80..306 CDD:238040 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.