DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Fgg

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_006232587.1 Gene:Fgg / 24367 RGDID:2613 Length:445 Species:Rattus norvegicus


Alignment Length:403 Identity:99/403 - (24%)
Similarity:158/403 - (39%) Gaps:85/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CIKDK------------DDFIKTLQLSIDLVTQTKEMTIQKLQTQIMDLQSDLDLSRITIKKNDG 132
            ||.|:            .||:.:.|..:|...||.|..:|:.:.:..:.:..:...::....:..
  Rat    35 CILDERFGSYCPTTCGISDFLNSYQTDVDTDLQTLENILQRAENRTTEAKELIKAIQVYYNPDQP 99

  Fly   133 GNCAPAHDKVVKERKELNMENGKFREGNDQIVEIEKILNSKEAEIARLE-------FKIDESKLK 190
            ...........|.:|.:           ::|::.|.:|.:.|:.|..|:       .||...|.|
  Rat   100 PKPGMIEGATQKSKKMV-----------EEILKYEALLLTHESSIRYLQDIYTSNKQKITNLKQK 153

  Fly   191 IVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEFVLLGSSKLPSIKLVTLPDFEPFASVFEDIP 255
            :.|||...:...:..|::      ::...||..:....|:.:.....:..|...:.|. |:.:|.
  Rat   154 VAQLEAQCQEPCKDSVRI------HDTTGKDCQDIANKGAKESGLYFIRPLKATQQFL-VYCEID 211

  Fly   256 SAGRGWMIIQRRIDGSFDNATESNII---TGCGDLG----GEFWLGLQKLHKMTTHRRM--ELYI 311
            .:|.||.::|:|:|||.|  .:.|.|   .|.|.|.    .|||||.:|:|.::....:  .|.|
  Rat   212 GSGNGWTVLQKRLDGSVD--FKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRI 274

  Fly   312 QLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDA--------------FRSH------ 356
            ||.|:...::.|.|..|.:|.|..||:|.......|:||||              |.||      
  Rat   275 QLKDWSGRTSTADYAMFRVGPESDKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMHFS 339

  Fly   357 ----INHIIVGNPFAMESSKWWGTMN-C---NLN------GKYRNSKVELDTTDGIWWGNWNVGN 407
                .|....||....:.|.||  || |   :||      |.|..|.......:||.|..|.. .
  Rat   340 TWDNDNDKFEGNCAEQDGSGWW--MNKCHAGHLNGVYYQGGTYSKSSTPNGYDNGIIWATWKT-R 401

  Fly   408 RYPLKSCKMLIRP 420
            .|.:|...|.|.|
  Rat   402 WYSMKETTMKIIP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 15/72 (21%)
FReD 245..421 CDD:294064 68/219 (31%)
FggXP_006232587.1 Fib_alpha 31..172 CDD:400857 27/153 (18%)
Fibrinogen_C 175..414 CDD:395095 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.