DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and ANGPTL2

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens


Alignment Length:459 Identity:109/459 - (23%)
Similarity:181/459 - (39%) Gaps:138/459 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QQEKGSILENCIKDKDDFI----KTLQLSIDLVTQTKEMTIQKLQTQIMDLQSDLDLSRITIKKN 130
            |:..|:|   |:..|:..:    :..:..::|:  ..|:..||  .||..||..:::        
Human    63 QRVTGAI---CVNSKEPEVLLENRVHKQELELL--NNELLKQK--RQIETLQQLVEV-------- 112

  Fly   131 DGGNCAPAHDKVVKERKELNMENGKFREGNDQIVE-----IEKILNSKE--AEIARLEFKIDESK 188
            |||        :|.|.|.|..|:   |..|.::.:     :.:|:..::  .|:::||.:|....
Human   113 DGG--------IVSEVKLLRKES---RNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQT 166

  Fly   189 LKIVQLEGAVKAKD----------------EKIVKMTE--------------------------- 210
            ..::||  |.|.||                |.|.::.|                           
Human   167 ADMLQL--ASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPT 229

  Fly   211 ---ILSEYNVNNKDHDEFVLLGSSKLPSIKLVT-------------------LPDFEPFASVFED 253
               |:::.:.|....|:.:.:....||::..:|                   |.|....:|::..
Human   230 YNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLV 294

  Fly   254 IP-SAGR-------------GWMIIQRRIDGS---FDNATESNIITGCGDLGGEFWLGLQKLHKM 301
            .| :..|             ||.:||||:|||   |.|  ......|.|::.||:||||:.::.:
Human   295 KPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRN--WETYKQGFGNIDGEYWLGLENIYWL 357

  Fly   302 TTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSH---------- 356
            |.....:|.:.:.|:.....:|.|.:|.:..|.:.|| |.||.|.|||||:|..|          
Human   358 TNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYK-LRLGRYHGNAGDSFTWHNGKQFTTLDR 421

  Fly   357 INHIIVGNPFAMESSKWW--GTMNCNLNGK-YRNSKVELDTTDGIWWGNWNVGNRYPLKSCKMLI 418
            .:.:..||....:...||  ...:.||||. ||.........||::|..:. |..|.||...|:|
Human   422 DHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFR-GGSYSLKKVVMMI 485

  Fly   419 RPMP 422
            ||.|
Human   486 RPNP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 19/118 (16%)
FReD 245..421 CDD:294064 62/205 (30%)
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 63/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.