DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and FGL1

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens


Alignment Length:282 Identity:96/282 - (34%)
Similarity:135/282 - (47%) Gaps:48/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 AEIARLEFKIDESKLKIVQL--EGAV----KAKDEKIVKMTEILSEYNVNNKDHDEFVLLGSSKL 233
            |::..||.::.:.::||.||  |..|    |..:..::.:.......:.:...:|.:.|.|..| 
Human    35 AQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYK- 98

  Fly   234 PSIKLVTLP-DFEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDL---GGEFWL 293
              ||.:..| :|    ||:.|: |.|.||.:||||.|||.: |....:...|.|:.   .||:||
Human    99 --IKPLQSPAEF----SVYCDM-SDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL 156

  Fly   294 GLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAF----- 353
            |.:.||.:||.....|.|.|.||:..|.||:|.||.:||||..|: |::|||||.|||:.     
Human   157 GNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYE-LNIGEYSGTAGDSLAGNFH 220

  Fly   354 ------------------RSHINHIIVGNPFAMESSKWWGTM--NCNLNGKYRNSKVELDTTDGI 398
                              |.|.|:  .||....:.|.||...  :.||||.|.:......|.:||
Human   221 PEVQWWASHQRMKFSTWDRDHDNY--EGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGI 283

  Fly   399 WWGNWNVGNRYPLKSCKMLIRP 420
            .|..|: |..|.|||..|.|||
Human   284 VWYTWH-GWWYSLKSVVMKIRP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 10/42 (24%)
FReD 245..421 CDD:294064 78/205 (38%)
FGL1NP_004458.3 FReD 78..304 CDD:238040 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.