DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and FGB

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:455 Identity:102/455 - (22%)
Similarity:180/455 - (39%) Gaps:130/455 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KKKDERKISELTRKLAEAEINLKAQQEKGSILENCIKDKD----DFIKTLQLSIDLVTQTKEMTI 106
            :||.|||..:....| .|:.:|......|..|:..:..::    :.:..|..:::.|:||...:.
Human    82 QKKVERKAPDAGGCL-HADPDLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSF 145

  Fly   107 QKLQTQIMDLQSDLDLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFREGNDQIVEIEKILN 171
                 |.|.|..||                                   :::...|:.:.|.::|
Human   146 -----QYMYLLKDL-----------------------------------WQKRQKQVKDNENVVN 170

  Fly   172 SKEAEIARLEFKIDE-------SKLKIVQ--LEGAVKAKDEKIVKMTEILSEY------------ 215
            ...:|:.:.:..|||       :.|::::  ||. :::|.:|:........||            
Human   171 EYSSELEKHQLYIDETVNSNIPTNLRVLRSILEN-LRSKIQKLESDVSAQMEYCRTPCTVSCNIP 234

  Fly   216 NVNNKDHDEFVLLG--SSKLPSIKLVTLPD--FEPFASVFEDIPSAGRGWMIIQRRIDGSFDNAT 276
            .|:.|:.:|.:..|  :|::..|:    ||  .:|: .|:.|:.:...||.:||.|.|||.|...
Human   235 VVSGKECEEIIRKGGETSEMYLIQ----PDSSVKPY-RVYCDMNTENGGWTVIQNRQDGSVDFGR 294

  Fly   277 E--------SNIITG------CGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDN 327
            :        .|:.|.      || |.||:|||..|:.::|.....||.|::.|:......|.|..
Human   295 KWDPYKQGFGNVATNTDGKNYCG-LPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGG 358

  Fly   328 FVIGDEKQKYKLLSLGEYSGNAGDAFRSHINHIIVGN------------PFAMESSKW------- 373
            |.:.:|..||: :|:.:|.|.||:|.....:.::..|            .:..::..|       
Human   359 FTVQNEANKYQ-ISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRK 422

  Fly   374 ---------WGTMNC---NLNGKYR-NSKVELD-----TTDGIWWGNWNVGNRYPLKSCKMLIRP 420
                     |....|   |.||:|. ..:...|     |.||:.|.||. |:.|.::...|.|||
Human   423 QCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWK-GSWYSMRKMSMKIRP 486

  Fly   421  420
            Human   487  486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 12/74 (16%)
FReD 245..421 CDD:294064 61/227 (27%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 28/183 (15%)
FReD 237..486 CDD:294064 66/256 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.