DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and FGA

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens


Alignment Length:544 Identity:123/544 - (22%)
Similarity:195/544 - (35%) Gaps:145/544 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SQNSRSSPDSSTENNSSSS----DSEMEFVGTSARGMLKHKKKDERKISELTRK----------- 59
            |.||.||...||.|.:..|    .:.....|:|.||...| ...|..:|..|.:           
Human   333 SWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSAGH-WTSESSVSGSTGQWHSESGSFRPD 396

  Fly    60 ----------------LAEAEINLKAQQEKGSILENCIKDKDDFIKTLQLSIDLVTQ----TKEM 104
                            ..|...|:.....:....|..:..|.|  |.|:...:.||.    |...
Human   397 SPGSGNARPNNPDWGTFEEVSGNVSPGTRREYHTEKLVTSKGD--KELRTGKEKVTSGSTTTTRR 459

  Fly   105 TIQKLQTQ-IMDLQSDLDLSRITIKKNDGGNCAPAHD---------------------------- 140
            :..|..|: ::......::::..:...||.:|..|.|                            
Human   460 SCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTAS 524

  Fly   141 --------------KVVKERKELNMENGKFREGNDQ------IVEIEKILNSKEAEIAR-----L 180
                          :.|.|.:....|:|.|....:.      |.|...  ..|.:..::     .
Human   525 TGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKESSSHHPGIAEFPS--RGKSSSYSKQFTSST 587

  Fly   181 EFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNN---KDHDEFVLLGSSKLPS-IKLVTL 241
            .:...:|..:....:.|.:|..|...:.|......:..:   :|.|:.:....|...| |..:.|
Human   588 SYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKL 652

  Fly   242 PDFEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDLG----GEFWLGLQKLHKM 301
            |......||:.|..::..||::||:|:|||.: |.|..:...|.|.|.    ||||||...|| :
Human   653 PGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLH-L 716

  Fly   302 TTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDA-----------FRS 355
            .|.|...|.::|.|:....|||.| :|.:|.|.:.| .|.:..|.|.||||           :.|
Human   717 LTQRGSVLRVELEDWAGNEAYAEY-HFRVGSEAEGY-ALQVSSYEGTAGDALIEGSVEEGAEYTS 779

  Fly   356 HINHIIVGNPFAMESSKW-----------WGTMNC---NLNGKY---------RNSKVELDTTDG 397
            |.|  :..:.|..::.:|           |...||   ||||.|         .||..|::  :|
Human   780 HNN--MQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIE--NG 840

  Fly   398 IWWGNWNVGNRYPLKSCKMLIRPM 421
            :.|.::. |..|.|::.:|.|||:
Human   841 VVWVSFR-GADYSLRAVRMKIRPL 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 11/76 (14%)
FReD 245..421 CDD:294064 68/214 (32%)
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 50..187 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460 27/129 (21%)
Fibrinogen_aC 445..509 CDD:288972 10/63 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 14/96 (15%)
FReD 630..863 CDD:238040 75/240 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.