DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and FCN2

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:201 Identity:71/201 - (35%)
Similarity:98/201 - (48%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 VTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFDNATE-SNIITGCGDLGGEFWLGLQKLHKMT 302
            :.|||..|. :|..|:.:.|.||.:.|||:|||.|...: :....|.|...||||||...:|.:|
Human   121 IYLPDCRPL-TVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALT 184

  Fly   303 THRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEY-SGNAGDAFRSHINH------- 359
            .....||.:.||||::...:|:|.:|.:.||.:||.|: ||.: .|:|||:...|.|.       
Human   185 AQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLV-LGAFVEGSAGDSLTFHNNQSFSTKDQ 248

  Fly   360 ---IIVGNPFAMESSKWWGTMNC---NLNGKYRNSKVELDTTDGIWWG--NWNVGN--RYPLKSC 414
               :..||...|....|| ..||   ||||:|      |..|.|.:..  ||..|.  .|..|..
Human   249 DNDLNTGNCAVMFQGAWW-YKNCHVSNLNGRY------LRGTHGSFANGINWKSGKGYNYSYKVS 306

  Fly   415 KMLIRP 420
            :|.:||
Human   307 EMKVRP 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 68/195 (35%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99
FReD 102..312 CDD:238040 69/199 (35%)