DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and C49C8.5

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_501481.2 Gene:C49C8.5 / 177668 WormBaseID:WBGene00016769 Length:451 Species:Caenorhabditis elegans


Alignment Length:249 Identity:58/249 - (23%)
Similarity:92/249 - (36%) Gaps:86/249 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SSKLP---------SIKLVTL-PDFEPFASVFEDIPSAGRGWMIIQRR--------IDGSFDNAT 276
            ::|||         |..|.|: ||.....||:.|..::...:.|||.|        .|..|.|.:
 Worm   187 TAKLPSDCDEVESTSSGLQTIYPDGSTPVSVYCDRKNSAGAYTIIQSRGREGSNITFDIPFANYS 251

  Fly   277 ESNIITGCGDLGGEFWLGLQKLHKMTTH-RRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLL 340
            :   ..|...:|..|||||..::.::|: :...|.|.|.......|...|.||.:..:.::|.|.
 Worm   252 D---WFGESGVGKNFWLGLDNMNNLSTNGKTYSLQIDLCCGTQLMAKQLYTNFKVATKAEQYALT 313

  Fly   341 S------LG-EYSGNAGDAFRSHINHIIVGNPFAME--------------------------SSK 372
            :      :| :||.:|.|          :|.||:.:                          .||
 Worm   314 ASADLPGIGLDYSSSAKD----------LGAPFSTQLTYSLPKGKAECDQFEFYDDDNGGAGPSK 368

  Fly   373 -----WWGTMNCNLNG-KYRNSK---------------VELDTTDGIWWGNWNV 405
                 |:|:...|||| .|.|:.               :.:.||.|...|.::|
 Worm   369 GYGGWWYGSCGNNLNGFLYPNNNGDCSVTKFDSTLLLGINMRTTTGTATGGYDV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 50/224 (22%)
C49C8.5NP_501481.2 FReD 190..437 CDD:294064 57/246 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.