Sequence 1: | NP_649170.1 | Gene: | CG7668 / 40190 | FlyBaseID: | FBgn0036929 | Length: | 422 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501481.2 | Gene: | C49C8.5 / 177668 | WormBaseID: | WBGene00016769 | Length: | 451 | Species: | Caenorhabditis elegans |
Alignment Length: | 249 | Identity: | 58/249 - (23%) |
---|---|---|---|
Similarity: | 92/249 - (36%) | Gaps: | 86/249 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 SSKLP---------SIKLVTL-PDFEPFASVFEDIPSAGRGWMIIQRR--------IDGSFDNAT 276
Fly 277 ESNIITGCGDLGGEFWLGLQKLHKMTTH-RRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLL 340
Fly 341 S------LG-EYSGNAGDAFRSHINHIIVGNPFAME--------------------------SSK 372
Fly 373 -----WWGTMNCNLNG-KYRNSK---------------VELDTTDGIWWGNWNV 405 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7668 | NP_649170.1 | DUF16 | 146..>212 | CDD:279814 | |
FReD | 245..421 | CDD:294064 | 50/224 (22%) | ||
C49C8.5 | NP_501481.2 | FReD | 190..437 | CDD:294064 | 57/246 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19143 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |