Sequence 1: | NP_649170.1 | Gene: | CG7668 / 40190 | FlyBaseID: | FBgn0036929 | Length: | 422 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_446086.1 | Gene: | Fcnb / 114091 | RGDID: | 621222 | Length: | 319 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 67/196 - (34%) |
---|---|---|---|
Similarity: | 95/196 - (48%) | Gaps: | 20/196 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 239 VTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFDNATE-SNIITGCGDLGGEFWLGLQKLHKMT 302
Fly 303 THRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEY-SGNAGDAFRSHINHII----- 361
Fly 362 -----VGNPFAMESSKWWGTMNC---NLNGKYRNSKVELDTTDGIWWGNWNVGNRYPLKSCKMLI 418
Fly 419 R 419 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7668 | NP_649170.1 | DUF16 | 146..>212 | CDD:279814 | |
FReD | 245..421 | CDD:294064 | 64/190 (34%) | ||
Fcnb | NP_446086.1 | Collagen | 45..100 | CDD:189968 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 53..106 | ||||
FReD | 108..317 | CDD:238040 | 66/194 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.860 |