DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and FGL2

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_006673.1 Gene:FGL2 / 10875 HGNCID:3696 Length:439 Species:Homo sapiens


Alignment Length:343 Identity:101/343 - (29%)
Similarity:160/343 - (46%) Gaps:66/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IQKLQTQIMDLQSDLDLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFREGNDQIVEIEKIL 170
            :::|::::..|.|:|        ||              .::|:|:.:|:..:.|  :|.:..|.
Human   130 VRELESEVNKLSSEL--------KN--------------AKEEINVLHGRLEKLN--LVNMNNIE 170

  Fly   171 NSKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSE--YNVNNKDHDEFVLLGSSKL 233
            |..::::|.|.|.::       .|:|    |..|.....:|.|.  .::..||..::..:|....
Human   171 NYVDSKVANLTFVVN-------SLDG----KCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSS 224

  Fly   234 PSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDLGGEFWLGLQK 297
            .:.::...|....| .|:.|:.:.|.||.::|.|:|||.: ..|..:...|.|:|..|||||..|
Human   225 ETYRVTPDPKNSSF-EVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDK 288

  Fly   298 LHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDA--FRSHINHI 360
            :|.:|..:.|.|.|.|.||:....||.||.|.:.:|..||: |.:|.|:|.||||  |..|.||.
Human   289 IHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYR-LHVGNYNGTAGDALRFNKHYNHD 352

  Fly   361 I--------------VGNPFAMESSKWW--GTMNCNLNGKYRNSKVELDTTDGIWWGNW-NVGNR 408
            :              .||.....||.||  ..::.||||||.:.|.. ...:||:||.| .|...
Human   353 LKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYR-GVRNGIFWGTWPGVSEA 416

  Fly   409 YP------LKSCKMLIRP 420
            :|      .|..||:|||
Human   417 HPGGYKSSFKEAKMMIRP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 14/65 (22%)
FReD 245..421 CDD:294064 75/202 (37%)
FGL2NP_006673.1 DUF460 <28..>161 CDD:331991 9/52 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..126
FReD 209..435 CDD:294064 79/229 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.