DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and angptl5

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_031752234.1 Gene:angptl5 / 100493165 XenbaseID:XB-GENE-479274 Length:347 Species:Xenopus tropicalis


Alignment Length:229 Identity:75/229 - (32%)
Similarity:103/229 - (44%) Gaps:49/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SKLPSIKLVTLPD--FEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDLGGEFW 292
            ||.||...:..|:  :.|| ..|.|:...|.||.:||:|||||.| ..:..:.:.|.|||.||||
 Frog   120 SKFPSGLYIIQPEGTYYPF-EAFCDMDYQGGGWTVIQKRIDGSVDFQRSWIDYMEGFGDLSGEFW 183

  Fly   293 LGLQKLHKMTTHRRME--LYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFR- 354
            |||:|...:...:...  |.|.|...|...|||.||:|.:.||..:: ::.:|.|||.||||.| 
 Frog   184 LGLKKTFCILNQKNTSFMLSIALEAEDGTLAYASYDSFWLEDESNQF-IMHVGRYSGTAGDALRG 247

  Fly   355 -------------------SHINHIIVGNPFAMES-------SKWWGTMNC---NLNGKYRNSKV 390
                               ...|.....|..::.|       |.||.: .|   ||||.::.:: 
 Frog   248 FKKEDNQNAMPFSTFDADNDRCNPSCTVNGKSINSCSLLNNRSGWWFS-QCGLANLNGVHKVTR- 310

  Fly   391 ELDTTDGIWWGNW-----NVGNRYPLKSCKMLIR 419
             |....||.|..|     ||    .:||..|.|:
 Frog   311 -LVDISGIHWNTWKEDKENV----KIKSVSMKIK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 70/213 (33%)
angptl5XP_031752234.1 FReD 108..340 CDD:238040 75/229 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.