DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and angpt4.2

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001191044.1 Gene:angpt4.2 / 100491105 XenbaseID:XB-GENE-5875042 Length:263 Species:Xenopus tropicalis


Alignment Length:202 Identity:68/202 - (33%)
Similarity:99/202 - (49%) Gaps:37/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 VFEDIPSAGRGWMIIQRR--IDGSFDNATESNIITGCGDLGGEFWLGLQKLHKMTTH--RRMELY 310
            ||.::.:.| ||.:|||.  .||.....|.:....|.|::.||.||||:.:|.:|..  |..||:
 Frog    65 VFCEMKADG-GWTLIQRHDGQDGLLFTRTWAEYKLGFGNISGEHWLGLENMHILTNQDSRASELF 128

  Fly   311 IQLVDFDNA-SAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHINHIIVGNPFA------- 367
            |.|..||:: .|:|.|.:|::..|.:.|: ||:|.||||||||||:. |:...||.|.       
 Frog   129 ISLEAFDDSDGAFALYSSFIVAPESKLYQ-LSVGNYSGNAGDAFRTG-NNNQDGNFFTTKDKDND 191

  Fly   368 ------------------MESSKWWGTM--NCNLNGKYRNSKVELDTTDGIWWGNWNVGNRYPLK 412
                              ..||.||.:.  |.||||::|..:..:.....:.||::....  .||
 Frog   192 KCNPCKIGDTRFSSCSRYQSSSGWWFSSCGNANLNGQWRPEENNVGWASSVHWGSYRATE--SLK 254

  Fly   413 SCKMLIR 419
            ..||.:|
 Frog   255 YSKMFVR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 68/202 (34%)
angpt4.2NP_001191044.1 FReD 32..261 CDD:238040 67/200 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.