DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and LOC100007488

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:174 Identity:52/174 - (29%)
Similarity:82/174 - (47%) Gaps:22/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 VFEDIPSAGR-----GWMIIQRRIDGSFD-NATESNIITGCGDLGGEFWLGLQKLHKMTTHRRME 308
            |:..:.|.|:     ||.:||||:|||.: .....:...|.|.:.||:||||:.|:::|.|::..
Zfish    56 VYCQMVSEGKDEDKGGWTVIQRRMDGSVNFYRPWRDYKRGFGKVEGEYWLGLENLYQLTRHKKFM 120

  Fly   309 LYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHINHIIVGNPFAMESSK- 372
            |.:.|.||:....:|:|.:|.:|.|.:.|||...|...|.|||....|  :.:..:.|..:... 
Zfish   121 LRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSGFTDGGAGDCLSGH--NDLKFSTFDKDQDTH 183

  Fly   373 ------------WWGTM-NCNLNGKYRNSKVELDTTDGIWWGNW 403
                        |:|:. |.|.||.|...:.......|:.|..|
Zfish   184 EKSCAKEYLGGFWYGSCHNTNPNGVYLWGEDPTHYAIGVCWSTW 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 52/174 (30%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 52/174 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.