DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom20 and TOM20

DIOPT Version :9

Sequence 1:NP_001262085.1 Gene:Tom20 / 40189 FlyBaseID:FBgn0036928 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_011596.1 Gene:TOM20 / 852973 SGDID:S000003314 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:43/172 - (25%)
Similarity:69/172 - (40%) Gaps:43/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKK----------------------T 51
            :.|...:|.....||.||||.:||:.|:::|.:|:|.:...|                      .
Yeast    11 LAITTAIAALSATGYAIYFDYQRRNSPQFRKVLRQRAKEQAKMEEQAKTHAKEVKLQKVTEFLSM 75

  Fly    52 GTAKSGVPNLNDHEAIERYFLQEIQLGETL-IARGDFESGVEHLANAIVVCGQPARLLQVLQSSL 115
            ..||..:|  :|....|..|...::.||.| :.:|...........|:.|..|||.||.:.|.|:
Yeast    76 ELAKDPIP--SDPSEREATFTTNVENGERLSMQQGKELEAASKFYKALTVYPQPADLLGIYQRSI 138

  Fly   116 PAQVFAMLIV--------KMQEF-----GNRA-----AEGND 139
            |..::..:|:        .:..|     |::|     ||.||
Yeast   139 PEAIYEYIILMIAILPPANVASFVKGVVGSKAESDAVAEAND 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom20NP_001262085.1 MAS20 13..124 CDD:396581 34/133 (26%)
TOM20NP_011596.1 3a0801s04tom 1..154 CDD:273378 36/144 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346470
Domainoid 1 1.000 45 1.000 Domainoid score I3094
eggNOG 1 0.900 - - E1_KOG4056
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I1869
Isobase 1 0.950 - 0.930827 Normalized mean entropy S1542
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002763
OrthoInspector 1 1.000 - - otm46531
orthoMCL 1 0.900 - - OOG6_104980
Panther 1 1.100 - - LDO PTHR12430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1534
SonicParanoid 1 1.000 - - X2147
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.