DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom20 and Tomm20l

DIOPT Version :9

Sequence 1:NP_001262085.1 Gene:Tom20 / 40189 FlyBaseID:FBgn0036928 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_083503.1 Gene:Tomm20l / 75266 MGIID:1922516 Length:152 Species:Mus musculus


Alignment Length:152 Identity:48/152 - (31%)
Similarity:82/152 - (53%) Gaps:25/152 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KTAIGIAAGVA---GTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKKTGTAKSGVP--NLND-- 63
            :..:|:.||:|   ..:.:.||:|.|.:|..||.::::::::||    .|..|:..|  .|.|  
Mouse     5 RLGVGLLAGLAAGGAVVLLSYCVYLDWRRHRDPAFRRRLQDKRR----AGQPKAQAPARQLWDPV 65

  Fly    64 -HEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVVCGQPARLLQVLQSSLPAQVFAMLIVKM 127
             .|.::.||.:|:|:|:..:.||:...|.|||.||::||.||..||...:.:||.:||.||:.|:
Mouse    66 KKEELQEYFFREVQMGKLCLIRGERGMGFEHLTNALLVCEQPKELLMFFKKTLPPEVFQMLLDKI 130

  Fly   128 QEFGNRAAEGNDGPIVLGQSSE 149
                         |::..|..|
Mouse   131 -------------PLICQQLEE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom20NP_001262085.1 MAS20 13..124 CDD:396581 42/118 (36%)
Tomm20lNP_083503.1 MAS20 24..127 CDD:280270 39/106 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4056
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52437
OrthoDB 1 1.010 - - D1316067at2759
OrthoFinder 1 1.000 - - FOG0002763
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1534
SonicParanoid 1 1.000 - - X2147
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.