DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom20 and Tomm20l

DIOPT Version :9

Sequence 1:NP_001262085.1 Gene:Tom20 / 40189 FlyBaseID:FBgn0036928 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_001072851.3 Gene:Tomm20l / 689996 RGDID:1586305 Length:206 Species:Rattus norvegicus


Alignment Length:160 Identity:52/160 - (32%)
Similarity:88/160 - (55%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KTAIGIAAGVA---GTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKKTGTAKSGVPNLNDHE-- 65
            :.::|:.|.:|   ....:.||:|.|::|..||.:::.:|::||..:  ..||:....|.|.|  
  Rat    62 RLSVGLLAALAAGGAVALLCYCVYLDRRRHRDPAFRRCLRDQRRAGQ--SNAKAPARQLWDPEKK 124

  Fly    66 -AIERYFLQEIQLGETLIARGDFESGVEHLANAIVVCGQPARLLQVLQSSLPAQVFAMLIVKMQE 129
             .::.:||||:|:|:..:|||:...|.||..||::|||||..||...:::||.:||.||:.|:  
  Rat   125 KTLQEFFLQEMQMGKLCLARGEHGMGFEHFTNALLVCGQPKELLMFFKNTLPPEVFQMLLYKI-- 187

  Fly   130 FGNRAAEGNDGPIVLGQ-----SSEQQLDG 154
                       ||:..|     ..::.|||
  Rat   188 -----------PIICQQLEADMHEQEVLDG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom20NP_001262085.1 MAS20 13..124 CDD:396581 43/116 (37%)
Tomm20lXP_001072851.3 MAS20 82..184 CDD:280270 41/103 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1316067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.