DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom20 and tomm20

DIOPT Version :9

Sequence 1:NP_001262085.1 Gene:Tom20 / 40189 FlyBaseID:FBgn0036928 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001005024.1 Gene:tomm20 / 448537 XenbaseID:XB-GENE-972815 Length:147 Species:Xenopus tropicalis


Alignment Length:138 Identity:78/138 - (56%)
Similarity:104/138 - (75%) Gaps:7/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEMNKTAIGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNK--KTGTAKSGVPNLND 63
            |:.:.||: .|||||.|.||:|||||||:||||||.:|.::||:||:.|  |....:|.:|:|.|
 Frog     1 MVVVGKTS-AIAAGVCGALFLGYCIYFDRKRRSDPNFKNRLREKRRKQKIAKERAGQSRLPDLKD 64

  Fly    64 HEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVVCGQPARLLQVLQSSLPAQVFAMLIVKM- 127
            .||::::||:||||||.|:|:||||.||:||.|||.:||||.:||||||.:||..||.||:.|: 
 Frog    65 AEAVQKFFLEEIQLGEELLAQGDFEKGVDHLTNAIAICGQPQQLLQVLQQTLPPPVFQMLLTKLP 129

  Fly   128 ---QEFGN 132
               |..||
 Frog   130 TINQRIGN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom20NP_001262085.1 MAS20 13..124 CDD:396581 68/112 (61%)
tomm20NP_001005024.1 MAS20 12..126 CDD:366901 69/113 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4376
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44649
Inparanoid 1 1.050 159 1.000 Inparanoid score I4159
OMA 1 1.010 - - QHG52437
OrthoDB 1 1.010 - - D1316067at2759
OrthoFinder 1 1.000 - - FOG0002763
OrthoInspector 1 1.000 - - oto102429
Panther 1 1.100 - - LDO PTHR12430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1534
SonicParanoid 1 1.000 - - X2147
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.