DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom20 and tomm20a

DIOPT Version :9

Sequence 1:NP_001262085.1 Gene:Tom20 / 40189 FlyBaseID:FBgn0036928 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_998201.1 Gene:tomm20a / 406309 ZFINID:ZDB-GENE-040426-1976 Length:145 Species:Danio rerio


Alignment Length:143 Identity:76/143 - (53%)
Similarity:101/143 - (70%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKKTGTAKSG---VPNLNDHEAIERYFL 72
            :|.||.|.||||||||||:||||||.::.|:||||:: ::|...|||   :|:|.|..|::::||
Zfish     8 VALGVCGALFIGYCIYFDRKRRSDPNFRTKLRERRKK-QRTAQDKSGLAQLPDLKDAAAVQKFFL 71

  Fly    73 QEIQLGETLIARGDFESGVEHLANAIVVCGQPARLLQVLQSSLPAQVFAMLIVKMQEFGNRAAEG 137
            .||||||.|:|:||:|.||:||.|||.|||||.:||||||.:||..||.||:.|:.....|    
Zfish    72 DEIQLGEELLAQGDYEQGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQR---- 132

  Fly   138 NDGPIVLGQSSEQ 150
                :|..||.|:
Zfish   133 ----MVSAQSLEE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom20NP_001262085.1 MAS20 13..124 CDD:396581 68/113 (60%)
tomm20aNP_998201.1 MAS20 11..123 CDD:280270 68/112 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1316067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1534
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.