DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tom20 and tom20

DIOPT Version :9

Sequence 1:NP_001262085.1 Gene:Tom20 / 40189 FlyBaseID:FBgn0036928 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_593293.1 Gene:tom20 / 2542959 PomBaseID:SPAC6F12.07 Length:152 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:35/134 - (26%)
Similarity:61/134 - (45%) Gaps:21/134 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IAAGVAGTLFIGYCIYFDKKRRSDPEYK-------KKVRERRRRNKKTGTAK------------S 56
            |...:..|..:||.||||.|||:||.::       |||.|.:::.:|..|.|            :
pombe     6 IIGSLLATAAVGYAIYFDYKRRNDPHFRKTLKRRYKKVHEAKKQEEKLATKKFDITVEEALQVVA 70

  Fly    57 GVPNLNDHEAIERYFLQEIQLGETLIAR--GDFESGVEHLANAIVVCGQPARLLQVLQSSLPAQV 119
            ..|..:..|..|.:|:|::..||.|..:  .:.:.......:|:.|..||..|..:.:.::|..:
pombe    71 STPVPSSAEEKELFFMQQVARGEQLFQQQPDNIKESAACFYSALKVYPQPVELFAIYERTVPEPI 135

  Fly   120 FAML 123
            ..:|
pombe   136 MNLL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tom20NP_001262085.1 MAS20 13..124 CDD:396581 34/132 (26%)
tom20NP_593293.1 3a0801s04tom 5..144 CDD:273378 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3382
eggNOG 1 0.900 - - E1_KOG4056
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2038
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002763
OrthoInspector 1 1.000 - - otm47015
orthoMCL 1 0.900 - - OOG6_104980
Panther 1 1.100 - - LDO PTHR12430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1534
SonicParanoid 1 1.000 - - X2147
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.