DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and GUCA1C

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_005450.3 Gene:GUCA1C / 9626 HGNCID:4680 Length:209 Species:Homo sapiens


Alignment Length:153 Identity:54/153 - (35%)
Similarity:90/153 - (58%) Gaps:5/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAIDVTSS 96
            ||:.|..:.|:|..|..:|..:..:...:..|.:..|.|:.|||.:|:|::||.||:.|:::...
Human    22 WYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVNLIMQ 86

  Fly    97 GTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMDENN 161
            ...|:||||.|::||.||||.||..|:..:..|:..:.|     :...|.||....:|.|:|.||
Human    87 EKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNG-----QQTLSPEEFINLVFHKIDINN 146

  Fly   162 DGQLTQDEFLKGCLQDEELSKML 184
            ||:||.:||:.|..:|::|.:::
Human   147 DGELTLEEFINGMAKDQDLLEIV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 52/145 (36%)
GUCA1CNP_005450.3 FRQ1 15..165 CDD:227455 53/147 (36%)
EFh 56..118 CDD:238008 27/61 (44%)
EFh 92..160 CDD:238008 31/72 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.