DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CBL8

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:164 Identity:46/164 - (28%)
Similarity:82/164 - (50%) Gaps:12/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQ----DCPNGRLTPAKFVDMYKMFFPSGNAEE-FCDHVFR 72
            ||...|.:.|.:....|:..:..||:    ...:|.:...:|:   ...|.:|:.:. |.|.||.
plant    20 EDPHVLASETPFTVNEIEALHDLFKKLSTSIINDGLIHKEEFL---LALFRNGSMQNLFADRVFY 81

  Fly    73 TFDMDKNGYIDFKEFLLAIDVTSSGTPE-EKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGA 136
            .||..:||.|:|.||:.::.:....||| ||..:.|:::|:.|.|.|:..|:.|:|.|   :||.
plant    82 MFDRKRNGVIEFGEFVRSLSIFHPYTPEHEKSAFMFKLFDLHGTGFIEPHELKKMVGA---LLGE 143

  Fly   137 CSSNRPADSAEERAKNIFAKMDENNDGQLTQDEF 170
            .......:|.|...:....::|.|.||::.::|:
plant   144 TDLELSEESIEAIVEQTMLEVDTNKDGKIDEEEW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 44/159 (28%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 43/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.