DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CBL2

DIOPT Version :10

Sequence 1:NP_649167.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_200410.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:192 Identity:50/192 - (26%)
Similarity:86/192 - (44%) Gaps:17/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKE-----DMEFLKTHTRYDEATIKEWYKGFKQ----DCPNGRLTPAKFVDMYKM 56
            :||....  |.|:     |.|.|...|.:..:.|:..|:.||:    ...:|.:...:|  ...:
plant    16 LGCFDLD--LYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEF--QLAL 76

  Fly    57 FFPSGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTP-EEKLKWAFRMYDVDGNGVIDI 120
            |..:.....|.|.||..||...||.:.|:||..|:.|.....| ::|:.::|::||:...|.|:.
plant    77 FKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIER 141

  Fly   121 QEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSK 182
            ||:.::|.|   .|.....|......|:.....|.:.|..:||::.::|:....|:...|.|
plant   142 QEVKQMVVA---TLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_649167.1 FRQ1 42..176 CDD:444056 35/134 (26%)
CBL2NP_200410.1 FRQ1 64..192 CDD:444056 35/132 (27%)

Return to query results.
Submit another query.