DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and SOS3

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001190377.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:182 Identity:51/182 - (28%)
Similarity:84/182 - (46%) Gaps:17/182 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTK-------EDMEFLKTHTRYDEATIKEWYKGFKQ----DCPNGRLTPAKFVDMY 54
            |||..||.:...       ||.|.|.:.|.:....::..|:.||:    ...:|.:...:|  ..
plant     1 MGCSVSKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEF--QL 63

  Fly    55 KMFFPSGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTP-EEKLKWAFRMYDVDGNGVI 118
            .:|........|.|.:|..||:.:||.|:|.||:.::.|.....| .||:|:||::||:...|.|
plant    64 ALFRNRNRRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFI 128

  Fly   119 DIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEF 170
            :.:|:.::|.|:........|.   |..|......|.:.|..|||::..||:
plant   129 EREELKEMVVALLHESELVLSE---DMIEVMVDKAFVQADRKNDGKIDIDEW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 43/158 (27%)
SOS3NP_001190377.1 FRQ1 29..187 CDD:227455 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.