DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CBL10

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_195026.1 Gene:CBL10 / 829437 AraportID:AT4G33000 Length:256 Species:Arabidopsis thaliana


Alignment Length:187 Identity:53/187 - (28%)
Similarity:90/187 - (48%) Gaps:37/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLSSKDRLTKE-DMEFLKTHTRYDEATIKEWYKGFKQ-DCPNGRLTPAKFVD---MYK-----MF 57
            |.|:..|..:. |:|.|...:::....::..|:.||: .|        ..:|   ::|     ..
plant    51 CRSTSPRTCQHADLERLARESQFSVNEVEALYELFKKLSC--------SIIDDGLIHKEELRLAL 107

  Fly    58 FPSGNAEE-FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSS-GTPEEKLKWAFRMYDVDGNGVIDI 120
            |.:...|. |.|.||..||..|||.|:|:||:.|:.|... .:.:||..:|||:||:...|.|:.
plant   108 FQAPYGENLFLDRVFDLFDEKKNGVIEFEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIER 172

  Fly   121 QEMTKIVQAIY---DMLGACSSNRPADSAEERAKNI----FAKMDENNDGQLTQDEF 170
            :|:.::|.||.   ||:          .::|....|    ||..|.:.||::::||:
plant   173 EEVQQMVSAILLESDMM----------LSDELLTMIIDKTFADADSDKDGKISKDEW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 48/171 (28%)
CBL10NP_195026.1 EF-hand_7 81..142 CDD:290234 21/68 (31%)
EFh 118..180 CDD:238008 24/61 (39%)
EF-hand_7 118..179 CDD:290234 24/60 (40%)
EFh 154..219 CDD:238008 22/74 (30%)
EF-hand_7 158..218 CDD:290234 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.