DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CBL7

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:163 Identity:39/163 - (23%)
Similarity:73/163 - (44%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DEATIKEWYKGFKQ----DCPNGRLTPAKFVDMY-----------KMFFPSGNAEEFCDHVFRTF 74
            |:...|..|:.||:    ||........:.|..|           .:|....|...|.:.||..|
plant    18 DQKKRKALYEVFKKLSGVDCQRNEGNVVEGVTCYYGEMNKEQFHVAIFQTDKNESLFSERVFDLF 82

  Fly    75 DMDKNGYIDFKEFLLAIDVTSSGTP-EEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACS 138
            |.:.:|.:.|:||..|:.|.....| ::|:..:|::||:...|.|:.|.:.::|.|.....|...
plant    83 DTNHDGLLGFEEFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASGMSQ 147

  Fly   139 SNRPADSAEERAKNIFAKMDENNDGQLTQDEFL 171
            |:...:|..::.   |.:.|..::|.:.::|::
plant   148 SDEIVESIIDKT---FVQADTKHEGMIDEEEWM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 39/163 (24%)
CBL7NP_194386.1 FRQ1 <74..186 CDD:227455 28/107 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.