DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CBL6

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:144 Identity:38/144 - (26%)
Similarity:72/144 - (50%) Gaps:8/144 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IKEWYKGFKQDCPNGRLTPAKF-VDMYKMFFPSGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAID 92
            |:..|:.||....||.:...:| :.::||   :.....|.|.||..||....|.:||:.|..::.
plant    45 IEALYELFKSISKNGLIDKEQFQLVLFKM---NTTRSLFADRVFDLFDTKNTGILDFEAFARSLS 106

  Fly    93 VTSSGTP-EEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAK 156
            |...... |:|::::|::||::..|.|..||:.::|.......|...|:...:|..::.   |.:
plant   107 VFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMVVRTLAESGMNLSDHVIESIIDKT---FEE 168

  Fly   157 MDENNDGQLTQDEF 170
            .|...||::.::|:
plant   169 ADTKLDGKIDKEEW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 38/144 (26%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 38/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.