DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CBL5

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_192051.2 Gene:CBL5 / 826671 AraportID:AT4G01420 Length:203 Species:Arabidopsis thaliana


Alignment Length:180 Identity:47/180 - (26%)
Similarity:85/180 - (47%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSK--DRLTKEDMEFLKTHTRYDEATIKEWYKGFKQ--DC--PNGRLTPAKFVDMYKMFFP 59
            |||:.||  :...:||:..|.:.|.:.||.::..:..|.:  .|  .:..||..||     .|..
plant     1 MGCVCSKQLEGRRQEDISLLASQTFFSEAEVEVLHGLFIKLTSCLSNDNLLTKEKF-----QFIL 60

  Fly    60 SGNAEE---FCDHVFRTFDMDKNGYIDFKEFLLAIDV-TSSGTPEEKLKWAFRMYDVDGNGVIDI 120
            ..|.::   ..:.:|..|||..:|.|||.||:..::: ..:.:|.:|..:|||:||....|.|:.
plant    61 IKNTKKRSLSAERIFGLFDMRNDGAIDFGEFVHTLNIFHPNSSPRDKAIFAFRLYDTRETGFIEP 125

  Fly   121 QEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEF 170
            :|:.:::..:.:......|....||...:.   |.:.|...||.:..:|:
plant   126 EEVKEMIIDVLEESELMLSESIIDSIVSKT---FEEADWKKDGIIDLEEW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 40/161 (25%)
CBL5NP_192051.2 FRQ1 13..181 CDD:227455 42/168 (25%)
EFh 71..132 CDD:298682 20/60 (33%)
EFh 107..172 CDD:238008 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.