DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Kcnip2

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006527533.1 Gene:Kcnip2 / 80906 MGIID:2135916 Length:286 Species:Mus musculus


Alignment Length:175 Identity:59/175 - (33%)
Similarity:104/175 - (59%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMD 77
            |.:|.|:..|::....::..|:|||.:||:|.:....|..:|..|||.|::..:...:|..||.:
Mouse   107 EGLEQLQEQTKFTRRELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSNYATFLFNAFDTN 171

  Fly    78 KNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRP 142
            .:|.:.|::|:..:.|...||.:::|.|||.:||::.:|.|..:||..|:::||||:|  ....|
Mouse   172 HDGSVSFEDFVAGLSVILRGTIDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMG--KYTYP 234

  Fly   143 A---DSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            |   ::..|..::.|.|||.|.||.:|.:||::.|.|||.:.:.:
Mouse   235 ALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQQDENIMRSM 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 55/162 (34%)
Kcnip2XP_006527533.1 FRQ1 109..275 CDD:227455 58/167 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.