DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and rcvrnb

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001304684.1 Gene:rcvrnb / 792903 ZFINID:ZDB-GENE-120815-1 Length:203 Species:Danio rerio


Alignment Length:183 Identity:64/183 - (34%)
Similarity:114/183 - (62%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDH 69
            |....|:::.::.|:|.|.|.:..:..||:.|..:||.||::..:|..:|..|||..:...:..|
Zfish     4 SRSSALSRDVLQELQTSTTYSQEQLFSWYQKFLNECPTGRISREQFQSIYASFFPDADPGAYAQH 68

  Fly    70 VFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDML 134
            |||:||.|.:|.:||||:::|:.:||||...|||:|||.:||||.||.|...|:.:||::|::|:
Zfish    69 VFRSFDADSDGTLDFKEYIVALHLTSSGKTVEKLEWAFALYDVDRNGSITKNEIHEIVKSIFNMI 133

  Fly   135 G-ACSSNRPAD--SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            . ....|.|.|  :.|:|...|:....:..:|::|:.||::|.:.::.:.:::
Zfish   134 SKEDQKNLPDDENTPEKRTDKIWDFFGKKENGKITEGEFIQGVMDNKHILRLI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 62/162 (38%)
rcvrnbNP_001304684.1 FRQ1 10..182 CDD:227455 62/171 (36%)
EFh 65..127 CDD:238008 32/61 (52%)
EFh 101..177 CDD:238008 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576106
Domainoid 1 1.000 57 1.000 Domainoid score I10809
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.