DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and guca1al

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001072507.1 Gene:guca1al / 779962 XenbaseID:XB-GENE-5751697 Length:188 Species:Xenopus tropicalis


Alignment Length:184 Identity:70/184 - (38%)
Similarity:111/184 - (60%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||..||.   |.:|::.::.|         .|||.|..:||:|:||..:|...:.:...||.|..
 Frog     1 MGNTSSS---TVDDLQAVEIH---------HWYKKFMTECPSGQLTLHEFKQFFGLRGLSGEANS 53

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            :.:.:||||||:|:|||||.|::.|:.:...|..|:||:|.|::|||||||.||..|:..|::|:
 Frog    54 YIEQMFRTFDMNKDGYIDFMEYVAALSLVLRGKIEQKLRWYFKLYDVDGNGCIDRHELLNIIKAV 118

  Fly   131 YDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            ..:.| |..:   .:|||....:|.|:|.|.||:|:.:||::|..:|||...::
 Frog   119 RAING-CDHD---TTAEEFTNRVFDKIDVNGDGELSLEEFVEGARKDEEFMDVM 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 61/159 (38%)
guca1alNP_001072507.1 FRQ1 16..162 CDD:227455 61/158 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.