DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Kcnip1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017170240.1 Gene:Kcnip1 / 70357 MGIID:1917607 Length:249 Species:Mus musculus


Alignment Length:179 Identity:64/179 - (35%)
Similarity:103/179 - (57%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMD 77
            |.:|.|:..|.:.:..::..|:|||.:||:|.:....|..:|..|||.|:|..:..::|..||..
Mouse    66 EGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTT 130

  Fly    78 KNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVID----IQEMTKIVQAIYDMLGACS 138
            :.|.:.|::|:.|:.:...||..|||:|.|.:||::.:|.|:    .|||..||:|||||:|  .
Mouse   131 QTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEVPFQEMMDIVKAIYDMMG--K 193

  Fly   139 SNRPA---DSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            ...|.   |:..:.....|.|||:|.||.:|.||||:.|.:|:.:.:.|
Mouse   194 YTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 60/166 (36%)
Kcnip1XP_017170240.1 FRQ1 68..238 CDD:227455 62/171 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833424
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.