DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Clxn

DIOPT Version :10

Sequence 1:NP_649167.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006522537.1 Gene:Clxn / 66793 MGIID:1914043 Length:244 Species:Mus musculus


Alignment Length:119 Identity:34/119 - (28%)
Similarity:65/119 - (54%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYD 132
            |.|||.||.|.:|.|...|::..:.:...||.:||:|:.|.::|::|:|.|..:||..:::  ..
Mouse    71 DRVFRGFDKDNDGCISVSEWIHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEMFHMLK--NS 133

  Fly   133 MLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLAP 186
            :|...|...|.:..::..:....|||.::||:|:..::.|...::..|.:...|
Mouse   134 LLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYEKAVREENLLLEAFGP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_649167.1 FRQ1 42..176 CDD:444056 32/107 (30%)
ClxnXP_006522537.1 FRQ1 <67..177 CDD:444056 32/107 (30%)

Return to query results.
Submit another query.