DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Kcnip3

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017447516.1 Gene:Kcnip3 / 65199 RGDID:70888 Length:290 Species:Rattus norvegicus


Alignment Length:171 Identity:65/171 - (38%)
Similarity:101/171 - (59%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMD 77
            |.::.|:..|::.:..::..|:|||.:||.|.:....|..:|..|||.|:|..:...:|..||.|
  Rat   111 EGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDATTYAHFLFNAFDAD 175

  Fly    78 KNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRP 142
            .||.|.|::|::.:.:...||..|||||||.:||::.:|.|..:||..|:::||||:|  ....|
  Rat   176 GNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMG--RHTYP 238

  Fly   143 ---ADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEEL 180
               .|:..|..:..|.|||.|.||.:|.||||:.|.:||.:
  Rat   239 ILREDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 62/162 (38%)
Kcnip3XP_017447516.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.