DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Ncs1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_077342.1 Gene:Ncs1 / 65153 RGDID:68417 Length:190 Species:Rattus norvegicus


Alignment Length:190 Identity:83/190 - (43%)
Similarity:114/190 - (60%) Gaps:11/190 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||  .|..:|..|.:|.|...|.:.|..:::|||||.:|||:|:|..|.|..:||.|||.|:..:
  Rat     1 MG--KSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTK 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |...||..||.:|:|.|:|.||:.|:.|||.||.:|||:|||::||:|.:|.|...||..||.||
  Rat    64 FATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAI 128

  Fly   131 YDMLGAC-----SSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLA 185
            |.|:|..     ..|.|    |:|...|||.||:|.||:||..||.:|...|..:.:.|:
  Rat   129 YQMVGNTVELPEEENTP----EKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 75/164 (46%)
Ncs1NP_077342.1 FRQ1 20..179 CDD:227455 75/162 (46%)
Ancestral calcium site 1 36..47 5/10 (50%)
Interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:P62166 174..190 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.