DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Kcnip3

DIOPT Version :10

Sequence 1:NP_649167.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001277934.1 Gene:Kcnip3 / 56461 MGIID:1929258 Length:284 Species:Mus musculus


Alignment Length:171 Identity:65/171 - (38%)
Similarity:101/171 - (59%) Gaps:5/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMD 77
            |.::.|:..|::.:..::..|:|||.:||.|.:....|..:|..|||.|:|..:...:|..||.|
Mouse   105 EGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDATTYAHFLFNAFDAD 169

  Fly    78 KNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRP 142
            .||.|.|::|::.:.:...||..|||||||.:||::.:|.|..:||..|:::||||:|  ....|
Mouse   170 GNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKSIYDMMG--RHTYP 232

  Fly   143 ---ADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEEL 180
               .|:..|..:..|.|||.|.||.:|.||||:.|.:||.:
Mouse   233 ILREDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_649167.1 FRQ1 42..176 CDD:444056 54/136 (40%)
Kcnip3NP_001277934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..57
FRQ1 135..269 CDD:444056 54/135 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.