DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:159 Identity:59/159 - (37%)
Similarity:100/159 - (62%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EWYKGFKQDCPNGRLTPAKFVDMYKMFFPSG----NAEEFCDHVFRTFDMDKNGYIDFKEFLLAI 91
            ||::.|..:||:|.:|..:|    :..|.:|    .:.|:.:.:|||.|.:.:|.:||:|::.||
Zfish    21 EWFRKFLNECPSGLITLHEF----RRHFCNGTVGKESAEYAEQIFRTLDNNGDGVVDFREYVTAI 81

  Fly    92 DVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPAD-SAEERAKNIFA 155
            .:...|:..|||:|:|::||.|.:|.|...||.:|:||:|.|..|.|..:|.. :|||....||.
Zfish    82 SMLIEGSTVEKLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMSVAASLTKPDPLTAEECTNRIFV 146

  Fly   156 KMDENNDGQLTQDEFLKGCLQDEELSKML 184
            ::|::|:..::||||::|.|.||.:.:||
Zfish   147 RLDKDNNAIISQDEFIEGALNDEWIREML 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 55/151 (36%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 15/50 (30%)
EF-hand_7 32..81 CDD:290234 14/52 (27%)
EFh 56..118 CDD:238008 24/61 (39%)
EF-hand_7 57..117 CDD:290234 23/59 (39%)
EFh 92..164 CDD:238008 30/71 (42%)
EF-hand_7 93..163 CDD:290234 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.