DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and efcab1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001038325.1 Gene:efcab1 / 558421 ZFINID:ZDB-GENE-040914-40 Length:216 Species:Danio rerio


Alignment Length:139 Identity:45/139 - (32%)
Similarity:74/139 - (53%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AKFVDMYKMFFPSGNAEE-FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYD 111
            |||.::....|  |..:: ..|.|.|..|.|.:||:..||::.|:.|...||.:||:|:.|.:||
Zfish    57 AKFRNILHHTF--GMTDDMMTDRVCRVIDKDNDGYLSVKEWVEALSVFLRGTLDEKMKYCFEVYD 119

  Fly   112 VDGNGVIDIQEMTKIVQAIYDMLGACSSNRPA-DSAEERAKNI----FAKMDENNDGQLTQDEFL 171
            ::|:|.|..:||       :.||......:|. :..:|..|:|    ..|||.::||:::..:|.
Zfish   120 LNGDGYISREEM-------FQMLKDSLIRQPTEEDPDEGIKDIVEIALKKMDYDHDGRVSYADFE 177

  Fly   172 KGCLQDEEL 180
            | .:.||.|
Zfish   178 K-TVMDENL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 42/135 (31%)
efcab1NP_001038325.1 EFh 80..136 CDD:238008 23/62 (37%)
EF-hand_7 80..135 CDD:290234 22/61 (36%)
EFh 110..176 CDD:238008 21/72 (29%)
EF-hand_7 111..178 CDD:290234 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.