DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and ncalda

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001107882.1 Gene:ncalda / 556178 ZFINID:ZDB-GENE-080220-28 Length:193 Species:Danio rerio


Alignment Length:186 Identity:90/186 - (48%)
Similarity:124/186 - (66%) Gaps:5/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||..:||  |..|.|:.|...|.:.|..|:||||||.:|||:|.|:..:|..:|..|||.|:|.:
Zfish     1 MGKQNSK--LRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGNLSMEEFKKIYGNFFPYGDASK 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |.:|||||||.:.:|.|||:||::|:.|||.|..|:||||||.|||:||||.|...||.:|||||
Zfish    64 FAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKSEMLEIVQAI 128

  Fly   131 YDMLGACSSNRPADSA--EERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            |.|:.:. ...|.|.:  |:|.:.||.:||.|.||:|:.:||:||...|..:.::|
Zfish   129 YKMVSSV-MKMPEDESTPEKRTEKIFRQMDTNRDGKLSLEEFIKGAKTDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 81/161 (50%)
ncaldaNP_001107882.1 FRQ1 14..179 CDD:227455 82/165 (50%)
EFh <36..89 CDD:298682 26/52 (50%)
EFh 65..126 CDD:238008 36/60 (60%)
EFh 100..174 CDD:238008 39/74 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10809
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.