DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and efcab1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:113 Identity:37/113 - (32%)
Similarity:64/113 - (56%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYD 132
            |.|||.||.|.:.||...|::..:.|...||.||::|:.|.:||::|:|.|..:||..:::  ..
 Frog    70 DRVFRGFDKDNDSYISVTEWVEGLSVFLRGTLEERIKYCFGVYDLNGDGYISREEMFHMLK--NS 132

  Fly   133 MLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEEL 180
            :|...|...|.:..::..:....|||.::|.:|:..:|.| .:|:|.|
 Frog   133 LLKQPSEEDPDEGVKDLVEIALKKMDYDHDSKLSYMDFEK-AVQEENL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 35/109 (32%)
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 24/58 (41%)
EFh 71..130 CDD:238008 23/58 (40%)
EFh 104..175 CDD:238008 19/73 (26%)
EF-hand_7 105..174 CDD:290234 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.