DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and Hpcal1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001380981.1 Gene:Hpcal1 / 50871 RGDID:708375 Length:193 Species:Rattus norvegicus


Alignment Length:186 Identity:90/186 - (48%)
Similarity:125/186 - (67%) Gaps:5/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||..:||  |..|.::.|:.||.:.:..::||||||.:|||.|.||..:|..:|..|||.|:|.:
  Rat     1 MGKQNSK--LRPEVLQDLREHTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASK 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |.:|||||||.:.:|.|||:||::|:.|||.|..|:||||||.|||:||||.|...||.:|||||
  Rat    64 FAEHVFRTFDTNSDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAI 128

  Fly   131 YDMLGACSSNRPADSA--EERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            |.|:.:. ...|.|.:  |:|...||.:||.||||:|:.:||:||...|..:.::|
  Rat   129 YKMVSSV-MKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 82/161 (51%)
Hpcal1NP_001380981.1 FRQ1 13..179 CDD:227455 83/166 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336984
Domainoid 1 1.000 59 1.000 Domainoid score I10424
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.