DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and LOC500007

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006236139.1 Gene:LOC500007 / 500007 RGDID:1588445 Length:217 Species:Rattus norvegicus


Alignment Length:189 Identity:49/189 - (25%)
Similarity:93/189 - (49%) Gaps:21/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLTKEDMEFLKTHTRYD-EATIKEWYKGFKQDCPNGRLTPAK-----FVDMYKMFFPSGNAEEFC 67
            :|.:...:.:|...::: |..|:.:|.  ...||.|::...|     |..:.:.||...| :...
  Rat     8 KLVESFRKTVKCFKKFEVECLIQLFYS--LAGCPIGKVDNTKLDCNAFRGVLQNFFGMTN-DVLM 69

  Fly    68 DHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYD 132
            :.||..||.|.:.:::.:|::..:.|...||.|||:::.|.:|.:.|:..|..::       |:|
  Rat    70 NRVFFVFDKDGDSHVNLQEWIKGLAVFLRGTFEEKMRFCFEVYYLSGDAYISREK-------IFD 127

  Fly   133 ML-GACSSNRPADSAEERAKNI----FAKMDENNDGQLTQDEFLKGCLQDEELSKMLAP 186
            || .:...|.|.:..||..|::    ..|||.:|||:::.::|.|...:|..|.:...|
  Rat   128 MLKSSLFHNSPEEENEEGIKDLVEISLKKMDYDNDGKISFEDFEKAVRKDGLLLEAFGP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 45/170 (26%)
LOC500007XP_006236139.1 EFh 104..175 CDD:298682 22/77 (29%)
EF-hand_7 105..174 CDD:290234 21/75 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.