DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and guca1g

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001011660.1 Gene:guca1g / 494572 ZFINID:ZDB-GENE-050120-1 Length:187 Species:Danio rerio


Alignment Length:159 Identity:53/159 - (33%)
Similarity:91/159 - (57%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE---FCDHVFRTFDMDKNGYIDFKEFLLA 90
            |:..|..|.:.||:|.|...:|   .::|....::||   :.:.:|::||.:::..|||.||:.|
Zfish    18 IQPLYTRFMKVCPSGALHLHEF---RRIFGVQSSSEEEALYMETIFKSFDTNRDNVIDFMEFVAA 79

  Fly    91 IDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFA 155
            :.:...|..|::|||:|::||.|.||.:|.||:..:::    :|.....||...:..|....||.
Zfish    80 VHLVLRGNLEDRLKWSFKVYDRDENGKLDRQEVIHVIR----ILCKLKKNRINMTPVEICDRIFE 140

  Fly   156 KMDENNDGQLTQDEFLKGCLQDEELSKML 184
            .:|||||||::..|||:|..:|..:..:|
Zfish   141 LLDENNDGQISLSEFLEGAEKDAWIMDLL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 51/151 (34%)
guca1gNP_001011660.1 EF-hand_8 30..80 CDD:290545 15/52 (29%)
EFh 59..117 CDD:238008 23/57 (40%)
EFh 91..158 CDD:238008 28/70 (40%)
EF-hand_7 92..157 CDD:290234 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.