DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and kcnip1b

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021334841.1 Gene:kcnip1b / 494089 ZFINID:ZDB-GENE-041212-57 Length:225 Species:Danio rerio


Alignment Length:193 Identity:66/193 - (34%)
Similarity:108/193 - (55%) Gaps:16/193 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SKDRL-----------TKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFP 59
            |||::           ..|.:|.|:..|.:.:..::..|:|||.:||:|.:....|..:|..|||
Zfish    28 SKDKVDDELEMTMVCHRPEGLEQLEAQTNFSKQELQVLYRGFKNECPSGVVNEDTFKHIYAQFFP 92

  Fly    60 SGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMT 124
            .|:|..:..::|..||...||.|.|::|::.:.....||..:||:|.|.:||::.:|.|:.:|||
Zfish    93 HGDASTYAHYLFHAFDTRNNGSIKFEDFVMGLSTLLRGTVRDKLEWTFHLYDINKDGFINKEEMT 157

  Fly   125 KIVQAIYDMLGACSSNRPA---DSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            :||:|||||:|  ....||   |..:......|.|||:|.||.:|.:||:..|.:||.:.:.:
Zfish   158 EIVRAIYDMMG--KYTYPALKGDVPKAHVDAFFEKMDKNKDGVVTLEEFVLACQEDENMMRSM 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 59/162 (36%)
kcnip1bXP_021334841.1 FRQ1 48..205 CDD:227455 58/158 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.