DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and rcvrn.2

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001008164.1 Gene:rcvrn.2 / 493526 XenbaseID:XB-GENE-5807318 Length:193 Species:Xenopus tropicalis


Alignment Length:178 Identity:62/178 - (34%)
Similarity:117/178 - (65%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTF 74
            |:||.:|.||.:|||.:..:.:||:.|.:..|||::|..:|..:|..|||:.:.:.:..||||:|
 Frog     9 LSKEVLEDLKANTRYSDDELCKWYESFSKQSPNGKITRTEFEKIYANFFPNSDPKSYARHVFRSF 73

  Fly    75 DMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSS 139
            |.:::|.:||:|:::|:.:||||....||:|||.::|||.||.|...|:.:|:.||:.|:.....
 Frog    74 DTNEDGTLDFREYIIALHLTSSGKTSLKLEWAFSLFDVDKNGEISKVEVLEIITAIFKMIPPEEQ 138

  Fly   140 NRPAD---SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            ...||   :.::||..::|...:::|.::.:.||::|.:.::|:.:::
 Frog   139 KNLADDENTPQKRADKLWAYFKKSDDAKIAEGEFIQGIMMNDEIMRLI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 57/162 (35%)
rcvrn.2NP_001008164.1 FRQ1 14..177 CDD:227455 58/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10582
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495747at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.