DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and ncaldb

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001003776.1 Gene:ncaldb / 445319 ZFINID:ZDB-GENE-040808-37 Length:192 Species:Danio rerio


Alignment Length:186 Identity:87/186 - (46%)
Similarity:123/186 - (66%) Gaps:5/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||..:||  |..|.::.|..:|.:.|..|.||||||.:|||:|.|:..:|..:|..|||.|:|.:
Zfish     1 MGKQNSK--LRPEVIQDLLDNTDFTEHEILEWYKGFLRDCPSGALSMDEFKKIYGNFFPYGDASK 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |.:|||||||.:.:|.|||:||::|:.|||.|..::||||||.|||:||||.|...||.:|||||
Zfish    64 FAEHVFRTFDANGDGTIDFREFIIALSVTSRGRLDQKLKWAFSMYDLDGNGYISKAEMLEIVQAI 128

  Fly   131 YDMLGACSSNRPADSA--EERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184
            |.|:.:. ...|.|.:  |:|...||.:||.|.||:|:.:||::|...|..:.::|
Zfish   129 YKMVSSV-MKMPEDESTPEKRTDKIFRQMDTNRDGKLSLEEFVEGAKNDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 79/161 (49%)
ncaldbNP_001003776.1 FRQ1 13..179 CDD:227455 80/166 (48%)
EFh <36..89 CDD:298682 26/52 (50%)
EFh 65..126 CDD:238008 35/60 (58%)
EFh 100..174 CDD:238008 38/74 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10809
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.