DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and d-cup

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:165 Identity:36/165 - (21%)
Similarity:71/165 - (43%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WYKGFKQDCPNG-RLTPAKFVD-------MYKMFFPSGNAEEFCDHVFRTFDMDKNG--YIDFKE 86
            :||...|:.|:. |:|.::||:       :|.|           |.|.|...:...|  ::...|
  Fly    44 YYKYSLQNGPSARRITSSQFVNIVIGFQQLYDM-----------DVVDRIVTLIAGGRKHVTPME 97

  Fly    87 FLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAK 151
            |:..:.:..|...|.|:::|:.:||.:|.|:     ..:|:.:..:.......:...:...:...
  Fly    98 FVNYMTILMSRDMERKMEFAYMVYDKNGMGI-----NREIISSSVERFFVGDDDEVLEMRLDMVD 157

  Fly   152 NIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLAP 186
            .:..|.||:.||.::.:|:....||...|.:.|.|
  Fly   158 FLLLKFDEDQDGYISFEEYRSIVLQQPRLLEFLGP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 33/155 (21%)
d-cupNP_650235.1 EF-hand_7 114..180 CDD:290234 12/70 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.