DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and sunz

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster


Alignment Length:193 Identity:46/193 - (23%)
Similarity:66/193 - (34%) Gaps:53/193 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTKEDMEFLKTHTRYDEATIKEWYKG--------------FKQDCPNGRLTPAKFVDMYKMFFPS 60
            ||.:||...|..|.| ...||.:...              |.:...|.|........:|.:|..|
  Fly     6 LTLDDMANNKFLTMY-STLIKSFAASTEFSTNEVVSLLIVFYKYALNNRSRMMSTSQLYNLFLVS 69

  Fly    61 GNAEEFCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTK 125
                      |..||:.   .||    .:::::|..|.......| .|::.|..||  .:||..|
  Fly    70 ----------FGIFDVT---IID----RISMNITQDGRSVSPEAW-MRLFCVFFNG--SLQERMK 114

  Fly   126 IVQAIYDMLGACSSNRPA--------------DSAEE-RA---KNIFAKMDENNDGQLTQDEF 170
            ....:|...||...||..              |...| ||   :.||.|.|.:.||.:..:|:
  Fly   115 FAFEVYTSGGAVVLNREVVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 42/185 (23%)
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.