DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and CG15177

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster


Alignment Length:146 Identity:32/146 - (21%)
Similarity:64/146 - (43%) Gaps:29/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMDKNGYIDFKEFLLAID-VTSSGTPEEKL----- 103
            ::|..:||:::: :.:.:.|......|..:|....|.||.::..:|.: ....|..|::|     
  Fly    94 VSPRAWVDLFEL-YTTEDLERRMKFAFEVYDTKNTGVIDREQVGVACEKFFHEGDDEDELIELRA 157

  Fly   104 ---KWAFRMYDVDGNGVIDIQEMTKIVQ---AIYDMLG-ACSSNRPADSAEERAKNIFAKMDENN 161
               ::..:.:|||.:|||..::.:.:|.   .:.:.|| ...||      |||  ::.|.:    
  Fly   158 DMTEFIMKKFDVDKDGVISFEDYSSVVSQQPVLVEFLGWLFPSN------EER--DLMAHV---- 210

  Fly   162 DGQLTQDEFLKGCLQD 177
               :..|..|..|..|
  Fly   211 ---INMDSMLNYCNPD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 32/146 (22%)
CG15177NP_649672.1 EF-hand_7 115..180 CDD:290234 15/64 (23%)
EFh 116..179 CDD:298682 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.