DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7646 and ncs1

DIOPT Version :9

Sequence 1:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_988973.1 Gene:ncs1 / 394570 XenbaseID:XB-GENE-953740 Length:190 Species:Xenopus tropicalis


Alignment Length:190 Identity:83/190 - (43%)
Similarity:115/190 - (60%) Gaps:11/190 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCLSSKDRLTKEDMEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEE 65
            ||  .|..:|..|.:|.|...|.:.|..:::|||||.:|||:|:|..|.|..:||.|||.|:..:
 Frog     1 MG--KSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTK 63

  Fly    66 FCDHVFRTFDMDKNGYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAI 130
            |...||..||.:|:|.|:|.||:.|:.|||.||.:|||:|||::||:|.:|.|...||..||.||
 Frog    64 FATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAI 128

  Fly   131 YDMLGAC-----SSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLA 185
            |.|:|..     ..|.|    |:|...|||.||:|:||:||..||.:|...|..:.:.|:
 Frog   129 YQMVGNTVELPEEENTP----EKRVDRIFAMMDKNSDGKLTLQEFQEGSKADPSIVQALS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 75/164 (46%)
ncs1NP_988973.1 FRQ1 20..179 CDD:227455 75/162 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369072at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.